PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG129400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 812aa    MW: 86688.7 Da    PI: 5.4895
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG129400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.8e-22104159156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++lgL+ rqVk+WFqNrR+++k
  Pavir.5KG129400.2.p 104 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSRRLGLDPRQVKFWFQNRRTQMK 159
                          678899***********************************************999 PP

2START185.43.1e-583215531206
                          HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCS.CHHHHHHHHHCCCGGCT-TT-S. CS
                START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla. 77 
                          ela +a++elvk+a+ +ep+W  s       e +n +e+  +f +  +     + +ea+r+sg+v+ ++++ lve+l+d + +W+ ++  
  Pavir.5KG129400.2.p 321 ELAISAMDELVKLAQIDEPLWLPSLngspnkETLNFEEYAHTFLPCIGvkpmgYVSEASRESGLVIiDDSVALVETLMDER-RWSDMFSs 409
                          57889********************66666666666677777766666***************997245679*********.99999999 PP

                          ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSEEE CS
                START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgi 152
                             ka+++e ++sg      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    ++  +R+++lpSg+
  Pavir.5KG129400.2.p 410 miaKATVIEEVTSGiagsrnGALLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDQNSAttsNAANIRCRRLPSGC 499
                          999************************************************************85423333335568999********** PP

                          EEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 153 liepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          ++++++ng +kvtwveh++++++++h+l+r+l++sgla+ga++w+a lqrqce+
  Pavir.5KG129400.2.p 500 VMQDTPNGFCKVTWVEHTEYDEASVHQLYRPLIRSGLAFGARRWLAMLQRQCEC 553
                          ****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-2285161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-2489161IPR009057Homeodomain-like
PROSITE profilePS5007118.285101161IPR001356Homeobox domain
SMARTSM003894.8E-21102165IPR001356Homeobox domain
CDDcd000866.90E-20103161No hitNo description
PfamPF000461.5E-19104159IPR001356Homeobox domain
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PROSITE profilePS5084846.46312556IPR002913START domain
SuperFamilySSF559611.04E-29315553No hitNo description
CDDcd088757.11E-114316552No hitNo description
SMARTSM002341.7E-45321553IPR002913START domain
PfamPF018526.8E-51322553IPR002913START domain
SuperFamilySSF559611.15E-21573779No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MSFGSLFDGG AGGGGGSGGM QFPFSAGFSS SPGLSLGLDN SAGGGMGGGR ALPGGPGAGG  60
GSGAAARDAD AENDSRSGSD HLDAMSGGGE DEDDAEPGNP RKRKKRYHRH TPQQIQELEA  120
LFKECPHPDE KQRGELSRRL GLDPRQVKFW FQNRRTQMKT QLERHENALL KQENDKLRAE  180
NMTIREAMRS PMCGSCGSPA MLGEVSLEEQ HLCIENARLK DELSRVYALA TKFLGKPMSM  240
LAGPLMQPHL SSLPMPSSSL ELAVGGFRGL GSIPSATMPG SMGEFAGGVS SPLGTVITPA  300
RATGSAPSAM VRIDDRSMLL ELAISAMDEL VKLAQIDEPL WLPSLNGSPN KETLNFEEYA  360
HTFLPCIGVK PMGYVSEASR ESGLVIIDDS VALVETLMDE RRWSDMFSSM IAKATVIEEV  420
TSGIAGSRNG ALLLMKAELQ VLSPLVPIRE VTFLRFCKQL AEGAWAVVDV SIDGLVRDQN  480
SATTSNAANI RCRRLPSGCV MQDTPNGFCK VTWVEHTEYD EASVHQLYRP LIRSGLAFGA  540
RRWLAMLQRQ CECLAILMSP DTVSANDSSV ITQEGKRSML KLARRMTENF CAGVSASSAR  600
EWSKLDGATG SIGENVRVMA RKSVDEPGEP PGVVLSAATS VWVPVAPEKL FNFLRDEQLR  660
AEWDILSNGG PMQEMANIAK GQEHGNSVSL LRASAMSANQ SSMLILQETR TDASGSMVVY  720
APVDIPAMQL VMNGGDSTYV ALLPSGFAIL PDGPSATTGH KTGGSLLTVA FQILVNSQPT  780
AKLTVESVET VNNLITCTIK KIKTALQCDA T*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199105PRKRKKR
2100104RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.166400.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968002.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like isoform X2
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLK3XEN00.0K3XEN0_SETIT; Uncharacterized protein
STRINGSi000344m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1